PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03295.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 205aa    MW: 23793.2 Da    PI: 8.9033
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03295.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.12.5e-1092142757
                              HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                               +rk +NRe+ArrsR +K+ +++ L+    +L +eN++  ++l      ++
  Rsa1.0_03295.1_g00001.1  92 KKRKKSNRESARRSRMKKQRYLDDLRSQLNQLNTENREIGNQLRYVMHYCQ 142
                              68999*******************************987766666555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-885135No hitNo description
SMARTSM003382.4E-1186150IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.71488134IPR004827Basic-leucine zipper domain
CDDcd147023.41E-1591142No hitNo description
SuperFamilySSF579599.64E-1092140No hitNo description
PfamPF001701.6E-792142IPR004827Basic-leucine zipper domain
PROSITE patternPS00036093108IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MSSILPGFLS QPEVANHVLT LETRFIPWDD GASDLLSIFD SPVCPVEVNP AVEKKNSCQI  60
LNKSHSCPDM EDKPSNLTGL NVCFPKRDEW QKKRKKSNRE SARRSRMKKQ RYLDDLRSQL  120
NQLNTENREI GNQLRYVMHY CQHANMENDR LRLEHKILHE KLLNLRQALV LRQIQQSSTC  180
ATWSCVNSTV VTVHQNTSML RDHVI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
190108QKKRKKSNRESARRSRMKK
29195KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619717.11e-114PREDICTED: regulatory protein opaque-2-like
TrEMBLA0A078HJJ01e-126A0A078HJJ0_BRANA; BnaAnng05020D protein
STRINGscaffold_33400002.11e-81(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.13e-42basic leucine-zipper 5